DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Alx3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001007013.2 Gene:Alx3 / 365900 RGDID:1359270 Length:343 Species:Rattus norvegicus


Alignment Length:357 Identity:90/357 - (25%)
Similarity:131/357 - (36%) Gaps:97/357 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DSEPEPE-------KLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYA-A 100
            |..|.|:       .|:|:..|...:|:.|  .|..|..| |.:|      |:.|:.|||... .
  Rat    23 DEAPGPQGTPDAAPHLRPAPPRGPRLSRFP--ACGPLEPY-LPEP------AKPPAKYLQDLGPG 78

  Fly   101 AMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPS---- 161
            .:.|..|.::     .||.|:....|.|.|..   .|:|.|     ....|.|..:..||.    
  Rat    79 PVLNGGHFYK-----GSSEAEEKASKAASFPQ---LPVDCR-----GGPRDGPSNVQGSPGPCLA 130

  Fly   162 --ESPLSHDGSGL----------SRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRL 214
              ..|||   .||          |:|:|:|..||..|:.|||:.|.:..|.....|.::|....|
  Rat   131 SLSVPLS---PGLPDSMELAKSKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDL 192

  Fly   215 TETQVKIWFQNRRYKTKRKQ----IQQHEAALLGASKRVPVQVLVREDGSTTYAH--MAAPGAG- 272
            ||.:|::||||||.|.::::    ||:.......|   ..:.||.|.|......:  .::||:| 
  Rat   193 TEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTTA---YDISVLPRTDSHPQLQNSLWSSPGSGS 254

  Fly   273 ---------HGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTA 328
                     .|:....::.|.|......|.:.:|......|..|..|    ..||.....||.  
  Rat   255 PGGPCLMPPEGIPSPCMSPYSHSHGNVAGFMGVPASPAAHPGIYSIH----GFPPALGGHSFE-- 313

  Fly   329 SSASSSPVPIPIPGAVRPQRTPCPSPNGQMMS 360
                                   |||:|...|
  Rat   314 -----------------------PSPDGDYKS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 22/52 (42%)
Alx3NP_001007013.2 Homeobox 157..210 CDD:395001 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.