DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nkx2-6

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001121125.1 Gene:Nkx2-6 / 364418 RGDID:1306149 Length:213 Species:Rattus norvegicus


Alignment Length:239 Identity:80/239 - (33%)
Similarity:91/239 - (38%) Gaps:77/239 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 SNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMA 209
            |:|.....|.|..:.|...|              |..||.|||..|||||.||||||.|||..:|
  Rat    34 SDDPRRAGPVPTVTRPRRKP--------------RVLFSQAQVLALERRFKQQRYLSAPEREHLA 84

  Fly   210 KSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLG---ASKRVPVQVLVREDGSTTYAHMAAPGA 271
            ..|:||.|||||||||||||.|| |.|.....|.|   |.:||.|.|||.:         ..|  
  Rat    85 SVLQLTSTQVKIWFQNRRYKCKR-QRQDQTLELAGHPLAPRRVAVPVLVLD---------VKP-- 137

  Fly   272 GHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPV 336
              .|||                              .:|..|.|.......|.|   ||.:.:|.
  Rat   138 --CLDP------------------------------DRHAFPSPYATTVLYSCF---SSYTGTPY 167

  Fly   337 PIPI--------PGAVRPQRTPCPSPNGQMMSVESGAESVHSAA 372
            ....        ||.:.|..:...||.||     |.|...|.||
  Rat   168 SASYAGRYTGAGPGPLAPLASSGFSPGGQ-----SAAPQGHLAA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 37/52 (71%)
Nkx2-6NP_001121125.1 Homeobox 53..107 CDD:395001 38/67 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.