DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and en

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster


Alignment Length:270 Identity:63/270 - (23%)
Similarity:99/270 - (36%) Gaps:92/270 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAGVSAAMAGLSKSLTTPFSINDILTRSNPETRRMSSVD----SEPEPEKLKPSSDRERSISKSP 66
            |:|.|:|.:.|:               |:|.:|..:|..    |.|:|:.:.|           |
  Fly   352 SSGCSSAASSLN---------------SSPSSRLGASGSGVNASSPQPQPIPP-----------P 390

  Fly    67 PLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATG-TSNSSAADYMQRKLAYF 130
            ....||.|                           |::::.....|| |:.....:.|.....| 
  Fly   391 SAVSRDSG---------------------------MESSDDTRSETGSTTTEGGKNEMWPAWVY- 427

  Fly   131 GSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSE-SPLSHDGSGLSRKKRSRAAFSHAQVFELERRF 194
                        || ..||..|..|....|.: ...::|      :||.|.|||..|:..|:|.|
  Fly   428 ------------CT-RYSDRPSSGPRYRRPKQPKDKTND------EKRPRTAFSSEQLARLKREF 473

  Fly   195 AQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDG 259
            .:.|||:...|.:::..|.|.|.|:||||||:|.|.|:.         .|:...:.:|::.:   
  Fly   474 NENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS---------TGSKNPLALQLMAQ--- 526

  Fly   260 STTYAHMAAP 269
             ..|.|...|
  Fly   527 -GLYNHTTVP 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 24/52 (46%)
enNP_523700.2 Homeobox 457..510 CDD:278475 24/52 (46%)
Engrail_1_C_sig 512..541 CDD:287495 5/37 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.