DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and eve

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:343 Identity:84/343 - (24%)
Similarity:123/343 - (35%) Gaps:99/343 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 YYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPP----LS 157
            |....|::::.||.|:.....                   ||.:....:......:|||    ..
  Fly     4 YRTYNMESHHAHHDASPVDQK-------------------PLVVDLLATQYGKPQTPPPSPNECL 49

  Fly   158 SSPSESPLSHDGSGLSRK---KRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQV 219
            |||..|.....||.:...   :|.|.||:..|:..||:.|.::.|:|.|.|.|:|..|.|.|:.:
  Fly    50 SSPDNSLNGSRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTI 114

  Fly   220 KIWFQNRRYKTKRKQI------------QQHEAALLGASKR------VPVQVLVREDGSTTYAHM 266
            |:||||||.|.||::|            ....|::|.|:..      .|.........:...|..
  Fly   115 KVWFQNRRMKDKRQRIAVAWPYAAVYSDPAFAASILQAAANSVGMPYPPYAPAAAAAAAAAAAVA 179

  Fly   267 AAPGAGHGLDPALINIYRHQLQLAYGGLP-LPQMQM---------PFPY----FYPQHKVPQPIP 317
            ..|....|:.|.              |:| :|.|||         |.||    :.|.|...:|.|
  Fly   180 TNPMMATGMPPM--------------GMPQMPTMQMPGHSGHAGHPSPYGQYRYTPYHIPARPAP 230

  Fly   318 P---------PTQSSSFVTASSASSSPVPI--PIPGA---------VRPQRTP------CPSPNG 356
            |         |....|..|.||.|:....:  .:|.|         |...:||      ..||:.
  Fly   231 PHPAGPHMHHPHMMGSSATGSSYSAGAAGLLGALPSATCYTGLGVGVPKTQTPPLDLQSSSSPHS 295

  Fly   357 QMMSVESGAESVHSAAED 374
            ..:|: |...|.|:...|
  Fly   296 STLSL-SPVGSDHAKVFD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 24/52 (46%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.