DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and otx5

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_851848.2 Gene:otx5 / 353179 ZFINID:ZDB-GENE-030508-1 Length:289 Species:Danio rerio


Alignment Length:264 Identity:64/264 - (24%)
Similarity:96/264 - (36%) Gaps:95/264 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 SESPLSHDGSGLS-------------RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSL 212
            |.:.|:..|:|:.             :::|.|..|:.||:..||..|::.||.....|.|:|..:
Zfish    11 SVNGLTLTGTGMDLLHSAVGYPNTPRKQRRERTTFTRAQLDVLEALFSKTRYPDIFMREEVALKI 75

  Fly   213 RLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDP 277
            .|.|::|::||:|||.|.:::|.||..    |.:|..|.:........::.:..:|..:|     
Zfish    76 NLPESRVQVWFKNRRAKCRQQQQQQTS----GQTKPRPPKKKSSPARDSSASEPSASTSG----- 131

  Fly   278 ALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPP-----TQSSSFVTA---SSASSS 334
                                      ||        .|.|||     |.|||..|.   |.||.|
Zfish   132 --------------------------PY--------SPPPPPPGTAITPSSSSATVSIWSPASIS 162

  Fly   335 PVPIPI--PGAVRPQRTPCP-----------------------------SPNGQMMSVESGAESV 368
            |:|.|:  |.....||:..|                             ||....:|...||.|.
Zfish   163 PLPDPLSAPSTACLQRSSYPMTYSQAPAYGQSYAASSSYFTGLDCSSYLSPMHPQLSASGGALSP 227

  Fly   369 HSAA 372
            .|.|
Zfish   228 MSGA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 21/52 (40%)
otx5NP_851848.2 Homeobox 42..94 CDD:278475 21/51 (41%)
TF_Otx 157..231 CDD:281521 18/73 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.