Sequence 1: | NP_732637.1 | Gene: | bap / 42537 | FlyBaseID: | FBgn0004862 | Length: | 382 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_851848.2 | Gene: | otx5 / 353179 | ZFINID: | ZDB-GENE-030508-1 | Length: | 289 | Species: | Danio rerio |
Alignment Length: | 264 | Identity: | 64/264 - (24%) |
---|---|---|---|
Similarity: | 96/264 - (36%) | Gaps: | 95/264 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 161 SESPLSHDGSGLS-------------RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSL 212
Fly 213 RLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDP 277
Fly 278 ALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPP-----TQSSSFVTA---SSASSS 334
Fly 335 PVPIPI--PGAVRPQRTPCP-----------------------------SPNGQMMSVESGAESV 368
Fly 369 HSAA 372 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bap | NP_732637.1 | Homeobox | 178..231 | CDD:278475 | 21/52 (40%) |
otx5 | NP_851848.2 | Homeobox | 42..94 | CDD:278475 | 21/51 (41%) |
TF_Otx | 157..231 | CDD:281521 | 18/73 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |