DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and nkx3-2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_835233.1 Gene:nkx3-2 / 337865 ZFINID:ZDB-GENE-030127-1 Length:245 Species:Danio rerio


Alignment Length:300 Identity:103/300 - (34%)
Similarity:135/300 - (45%) Gaps:71/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MAGLSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYK 77
            ||..|.|| .||||..||.|.. |:|.::.:|                       :|......:|
Zfish     1 MAVRSNSL-MPFSIQAILNRKE-ESRHLNELD-----------------------VCFSKSACWK 40

  Fly    78 LTQPKEIQPSARQPSNYLQYYA-AAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMR 141
            :....: .|.....:.:..|.: :.:..:|.............||            ||...|..
Zfish    41 IFDEMD-APERSDETEHKNYDSDSGLSEDNDAKAQIDAKPEKDAD------------LADETDQE 92

  Fly   142 RCTSNDSDCDSPPPLSSSPSESPLSHDGSG---LSRKKRSRAAFSHAQVFELERRFAQQRYLSGP 203
            ......|||         .|:...:.:.||   ..|||||||||||||||||||||..|||||||
Zfish    93 SAAKGLSDC---------VSDCNTAEEKSGDAPKQRKKRSRAAFSHAQVFELERRFNHQRYLSGP 148

  Fly   204 ERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAA 268
            ||:::|.||:|||||||||||||||||||:|:.....|...|:|:|.|:||||:|     ....:
Zfish   149 ERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDD-----RRQYS 208

  Fly   269 PGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYP 308
            |  |..|.|.|:::.             |....|:.|..|
Zfish   209 P--GELLRPPLLSLQ-------------PSYYYPYTYCLP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 45/52 (87%)
nkx3-2NP_835233.1 COG5576 65..>177 CDD:227863 62/132 (47%)
Homeobox 123..176 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6597
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4733
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003099
OrthoInspector 1 1.000 - - otm24386
orthoMCL 1 0.900 - - OOG6_108109
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4480
SonicParanoid 1 1.000 - - X4759
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.