DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and scro

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster


Alignment Length:385 Identity:108/385 - (28%)
Similarity:153/385 - (39%) Gaps:107/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQ 85
            :||||:.|||:......|::....:.|.|.:...||    |...||    ..|....:..|..:.
  Fly   113 STPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSS----SSINSP----GTLTTSTMANPYAMG 169

  Fly    86 PSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADY--MQRKLAYFGSTLAAPLDMRRCTSNDS 148
            .....|.  :|.|....||           .|.|..|  |:...:::|||...|   |...|.  
  Fly   170 TLYHSPG--VQTYCGPTDN-----------LSLAGHYTDMRNSASWYGSTANDP---RFAISR-- 216

  Fly   149 DCDSPPPLSSSPSESPLSHDG--SGLS----------------RKKRSRAAFSHAQVFELERRFA 195
                   |.||.:...:||.|  |||:                |:|| |..|:.|||:||||||.
  Fly   217 -------LMSSSASGTMSHMGNMSGLAACSVSDSKPLQFPLAQRRKR-RVLFTQAQVYELERRFK 273

  Fly   196 QQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR--------KQIQQHEAALLGASKRVPVQ 252
            ||||||.|||..:|..:.||.|||||||||.|||.||        :|.|.::.|  .:.:||.|.
  Fly   274 QQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPA--SSPRRVAVP 336

  Fly   253 VLVREDGSTTYAHMAAPGAGHG-----------------LDPALINIYRHQLQLAYGGLPLPQMQ 300
            |||::....:..:.::....||                 .:..::::..:    ..|||.|....
  Fly   337 VLVKDGKPCSGNNSSSQSQQHGTNSTSAGNNTGSANNGNANSGIVSVTAN----VSGGLNLITGD 397

  Fly   301 MPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIPGAVRPQRTPCPSPNGQMMS 360
            .|..:           .|.|.||...:..:...|.|.:        .:.||   |..:||
  Fly   398 APNSH-----------SPDTSSSLLASYGTVGGSNVAM--------LQQPC---NNTLMS 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 35/52 (67%)
scroNP_001015473.1 Homeobox 256..309 CDD:278475 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442243
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0842
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I4000
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.