DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and AgaP_AGAP005346

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_555988.2 Gene:AgaP_AGAP005346 / 3289950 VectorBaseID:AGAP005346 Length:461 Species:Anopheles gambiae


Alignment Length:383 Identity:105/383 - (27%)
Similarity:153/383 - (39%) Gaps:99/383 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDL-----GLYKLTQ 80
            :||.|::.:...:|...:...|:      |.|....||..:.|.|...|.|.:     ..|.:..
Mosquito     8 STPSSMHPVDPVANNRVKNSFSI------EHLLAKPDRSGTASTSSAGCYRGMDDRLASSYPIAH 66

  Fly    81 PKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTS 145
            |.::                   :|:..:|...|.::||.:::.   .....|.|.|....|..|
Mosquito    67 PAQL-------------------HNSMVYQTLMTRSASAVEFLD---VNKNETSAVPFAADRPPS 109

  Fly   146 NDSDCDSPPPLSSSPSE------SPLSHDGS---GLS----RKKRSRAAFSHAQVFELERRFAQQ 197
            ..::..||   .||.:|      |.::.:||   ||:    ||||.|.|||.||:..||..|.:.
Mosquito   110 ERAESSSP---ESSCNEDTMDNCSEIASEGSASGGLAAHDDRKKRPRTAFSAAQIKALETEFERG 171

  Fly   198 RYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRK------QIQQHEAALLGASK--------- 247
            :|||..:|:.:||.|.|||||:||||||||.|.|||      .:..|..:.||...         
Mosquito   172 KYLSVAKRTALAKQLHLTETQIKIWFQNRRTKWKRKYTADVESLASHYYSQLGIGSFARPMVVGD 236

  Fly   248 -----------RVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQM 301
                       ..|||.|:        .:...|||.....|||      .:|......|.|.:..
Mosquito   237 RLWLFSQTPNGPTPVQSLL--------LNGPQPGAAGASHPAL------GMQHPAAIRPYPTLSG 287

  Fly   302 PFPYFYPQHKVPQP-IPPPTQSSSFVTASSASSSPVPIPIPGAVRPQRTPCPSPNGQM 358
            |.|.....:..|:| :||....||..:|::|.        ||... .:.|.|||..:|
Mosquito   288 PIPMNAGPNFPPRPGMPPGAYLSSIPSAAAAG--------PGGFL-HKIPSPSPQSRM 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 30/52 (58%)
AgaP_AGAP005346XP_555988.2 Homeobox 152..205 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.