DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and OdsH

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster


Alignment Length:257 Identity:69/257 - (26%)
Similarity:98/257 - (38%) Gaps:76/257 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LYKLTQPKEIQPSARQP--SNYLQYYAAA-----------------MDNNNHHHQATGTSNSSAA 120
            :.:|.|....:...:.|  |:.||.||||                 ||..|........:|||:.
  Fly     5 IQQLQQAAAARGQVQHPHGSSALQLYAAAAAVNMQVSGWSSVLNLSMDAPNPEISPNSVTNSSSV 69

  Fly   121 DYMQRKLAYF--GSTLAAPLDMRRCTSNDSD----------------CDSPPPL-------SSSP 160
             ||.|::|..  ....||.:.|::......|                .||..|.       |...
  Fly    70 -YMIRQMALIQQARVAAAAVAMQQQQQQQRDLNRELGMDPHSEQRIKLDSVSPTHNIHAGSSRGI 133

  Fly   161 SESPLSHDG--SGL--------SRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLT 215
            .:.|||.:|  |.|        |:|:|.|..|:..|:.||||.|....|.....|..:|..|.|.
  Fly   134 KQDPLSDEGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLM 198

  Fly   216 ETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDP 277
            |.::.:||||||.|.::   |:|       :|:.|.:.          ||.|.|.:..| ||
  Fly   199 EGRIAVWFQNRRAKWRK---QEH-------TKKGPGRP----------AHNAHPQSCSG-DP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 21/52 (40%)
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.