DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and unc-4

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster


Alignment Length:143 Identity:45/143 - (31%)
Similarity:68/143 - (47%) Gaps:10/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 AAMDNNNHHHQATGTS-----NSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSS 159
            ||::.:|.....||.|     |.|||  ....:|...||:|.........:..|...:.||...|
  Fly   162 AAVNASNAFANLTGLSAAALRNVSAA--QTTAVAAVASTVATIQHRLMIGNRQSLPPAGPPSEGS 224

  Fly   160 PSESPLSHDG---SGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKI 221
            ..:.....||   |..::::|||..|:..|:.||||.|:...|.....|..:|..|.|.|::|.:
  Fly   225 NEDGGFPGDGDDDSSAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAV 289

  Fly   222 WFQNRRYKTKRKQ 234
            ||||||.|.::::
  Fly   290 WFQNRRAKVRKRE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 23/52 (44%)
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 23/52 (44%)
NK <327..>368 CDD:302627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.