DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and nkx2.9

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001093073.1 Gene:nkx2.9 / 325615 ZFINID:ZDB-GENE-030131-4340 Length:224 Species:Danio rerio


Alignment Length:196 Identity:77/196 - (39%)
Similarity:97/196 - (49%) Gaps:28/196 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 DMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGP 203
            |....:|:||:.::.|   .|.....||.|.....|||| |..||.||.:||||||.||||||.|
Zfish    46 DRGHISSDDSNIEASP---DSTEPDVLSVDTEHEKRKKR-RVLFSKAQTYELERRFRQQRYLSAP 106

  Fly   204 ERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQ----QHEAALLGASKRVPVQVLVREDGSTTYA 264
            ||.::|..||||.|||||||||.|||.||.:|:    .::..:|   :||.|.:||| ||.....
Zfish   107 EREQLAHLLRLTPTQVKIWFQNHRYKMKRARIECAQDLNQPPVL---RRVVVPILVR-DGKPYQN 167

  Fly   265 HMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTAS 329
            .......|:|:.|..:......:|    |....|.|.||..|            ||......||:
Zfish   168 CTIDTEKGNGIVPPTVPSSPFTVQ----GFHSLQQQTPFALF------------PTYQHFTNTAA 216

  Fly   330 S 330
            |
Zfish   217 S 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 37/52 (71%)
nkx2.9NP_001093073.1 Homeobox 81..134 CDD:306543 38/53 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D450160at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.