DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and HOXD1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_078777.1 Gene:HOXD1 / 3231 HGNCID:5132 Length:328 Species:Homo sapiens


Alignment Length:206 Identity:62/206 - (30%)
Similarity:85/206 - (41%) Gaps:43/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 AAMDNNNHHHQATGTSNSSAADYM---QRKLAYFGSTLAAPLDMRRCTSNDSD-------CDSPP 154
            ||.|..:|.|.||....|....::   |...|.||.    |.....|....:|       ..||.
Human   124 AADDGGSHVHYATSAVFSGGGSFLLSGQVDYAAFGE----PGPFPACLKASADGHPGAFQTASPA 184

  Fly   155 PLSSSPSESPLSHDGSGLS-----RKKRS-------------------RAAFSHAQVFELERRFA 195
            |.:...|.||.|...:..|     :.||:                   |..||..|:.|||:.|.
Human   185 PGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQLTELEKEFH 249

  Fly   196 QQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGS 260
            ..:||:...|.|:|..|.|.:|||||||||||.|.|::   :.|..|..|....|:|:.:  .|:
Human   250 FNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKR---EREGLLATAIPVAPLQLPL--SGT 309

  Fly   261 TTYAHMAAPGA 271
            |....:..||:
Human   310 TPTKFIKNPGS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 27/71 (38%)
HOXD1NP_078777.1 Antp-type hexapeptide 204..209 0/4 (0%)
Homeobox 233..285 CDD:278475 27/51 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.