Sequence 1: | NP_732637.1 | Gene: | bap / 42537 | FlyBaseID: | FBgn0004862 | Length: | 382 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055027.1 | Gene: | HOXC11 / 3227 | HGNCID: | 5123 | Length: | 304 | Species: | Homo sapiens |
Alignment Length: | 263 | Identity: | 61/263 - (23%) |
---|---|---|---|
Similarity: | 92/263 - (34%) | Gaps: | 80/263 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 PETRRMSS-VDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSAR--QPSNYLQ 96
Fly 97 YYAAA------------------MDN----NNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLD 139
Fly 140 MRRCTSNDSDCDSP-------------PPLS------------------SSPSESPLSHD----- 168
Fly 169 ----GSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYK 229
Fly 230 TKR 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bap | NP_732637.1 | Homeobox | 178..231 | CDD:278475 | 24/52 (46%) |
HOXC11 | NP_055027.1 | DUF3528 | 42..178 | CDD:288866 | 28/150 (19%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 166..237 | 9/70 (13%) | |||
Homeobox | 235..288 | CDD:278475 | 24/52 (46%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |