DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and HOXC11

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_055027.1 Gene:HOXC11 / 3227 HGNCID:5123 Length:304 Species:Homo sapiens


Alignment Length:263 Identity:61/263 - (23%)
Similarity:92/263 - (34%) Gaps:80/263 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PETRRMSS-VDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSAR--QPSNYLQ 96
            ||...:|| :...|..:...|.|      ::.||:.....||         :||.:  ..::|..
Human    42 PEFSTVSSFLPQAPSRQISYPYS------AQVPPVREVSYGL---------EPSGKWHHRNSYSS 91

  Fly    97 YYAAA------------------MDN----NNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLD 139
            .||||                  |.|    ..|||.:...:..:.......|.:..........|
Human    92 CYAAADELMHRECLPPSTVTEILMKNEGSYGGHHHPSAPHATPAGFYSSVNKNSVLPQAFDRFFD 156

  Fly   140 MRRCTSNDSDCDSP-------------PPLS------------------SSPSESPLSHD----- 168
            ...|...|...:.|             ||.|                  ::||.|..:|.     
Human   157 NAYCGGGDPPAEPPCSGKGEAKGEPEAPPASGLASRAEAGAEAEAEEENTNPSSSGSAHSVAKEP 221

  Fly   169 ----GSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYK 229
                .....|.::.|..:|..|:.||||.|....|::..:|.::::.|.||:.||||||||||.|
Human   222 AKGAAPNAPRTRKKRCPYSKFQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMK 286

  Fly   230 TKR 232
            .|:
Human   287 EKK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 24/52 (46%)
HOXC11NP_055027.1 DUF3528 42..178 CDD:288866 28/150 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..237 9/70 (13%)
Homeobox 235..288 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.