DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and HOXA13

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_000513.2 Gene:HOXA13 / 3209 HGNCID:5102 Length:388 Species:Homo sapiens


Alignment Length:176 Identity:45/176 - (25%)
Similarity:72/176 - (40%) Gaps:40/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KEIQPSARQPSNYLQYYAAAMDNNNHHHQ----------ATGTSNSSAADYMQRKLAYFGSTLAA 136
            :|....|::.:.|.|.|||   ...||||          ..|......:.:         ..|..
Human   219 EEFSSRAKEFAFYHQGYAA---GPYHHHQPMPGYLDMPVVPGLGGPGESRH---------EPLGL 271

  Fly   137 PLDMRR-------------CTSNDSDCDSPPPLSSSPSESPLSH--DGSGLSRKKRSRAAFSHAQ 186
            |::..:             |....:   .||.|..|.....:||  |.|...|.::.|..::..|
Human   272 PMESYQPWALPNGWNGQMYCPKEQA---QPPHLWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQ 333

  Fly   187 VFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR 232
            :.||||.:|..::::..:|..::.:..|:|.||.|||||||.|.|:
Human   334 LKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKK 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 20/52 (38%)
HOXA13NP_000513.2 HoxA13_N 85..222 CDD:403486 1/2 (50%)
Homeobox 325..379 CDD:395001 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.