Sequence 1: | NP_732637.1 | Gene: | bap / 42537 | FlyBaseID: | FBgn0004862 | Length: | 382 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_476786.2 | Gene: | vnd / 31003 | FlyBaseID: | FBgn0261930 | Length: | 723 | Species: | Drosophila melanogaster |
Alignment Length: | 253 | Identity: | 77/253 - (30%) |
---|---|---|---|
Similarity: | 98/253 - (38%) | Gaps: | 97/253 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 103 DNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSH 167
Fly 168 DGS---------GLSRKKRS-RAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIW 222
Fly 223 FQNRRYKTKRKQIQQ----------------HEAALLGASKRVPVQVLVRE-------------- 257
Fly 258 -----------------------DGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYG 292 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bap | NP_732637.1 | Homeobox | 178..231 | CDD:278475 | 35/53 (66%) |
vnd | NP_476786.2 | Homeobox | 548..601 | CDD:278475 | 35/52 (67%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45442242 | |
Domainoid | 1 | 1.000 | 53 | 1.000 | Domainoid score | I4196 |
eggNOG | 1 | 0.900 | - | - | E2759_KOG0842 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D450160at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24340 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.850 |