DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and vnd

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster


Alignment Length:253 Identity:77/253 - (30%)
Similarity:98/253 - (38%) Gaps:97/253 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 DNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSH 167
            :||||..:|.|.:.:             ||.....|:......:..|.|..              
  Fly   490 NNNNHSLKAEGINGA-------------GSGHDDSLNEDGIEEDIDDVDDA-------------- 527

  Fly   168 DGS---------GLSRKKRS-RAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIW 222
            |||         ||..|||. |..|:.||.:||||||.||||||.|||..:|..:|||.||||||
  Fly   528 DGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIW 592

  Fly   223 FQNRRYKTKRKQIQQ----------------HEAALLGASKRVPVQVLVRE-------------- 257
            |||.||||||.|.::                |..:.|.:.:||.|.||||.              
  Fly   593 FQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLGDSSKLGAD 657

  Fly   258 -----------------------DGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYG 292
                                   :|:..|.|.||..||       ::.:.|....|:|
  Fly   658 CVSVSSATATAMQNAAAHHLVALNGAAAYQHAAAAAAG-------LHAHAHAHAHAHG 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 35/53 (66%)
vndNP_476786.2 Homeobox 548..601 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442242
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0842
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D450160at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.