DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nkx2-3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001101064.1 Gene:Nkx2-3 / 309389 RGDID:1308521 Length:362 Species:Rattus norvegicus


Alignment Length:283 Identity:88/283 - (31%)
Similarity:123/283 - (43%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQ 85
            :||||:.|||...  :.|.......:.|         .|:.:..:|.:.....|.......:|.:
  Rat     9 STPFSVKDILNLE--QQRHFHGAHLQAE---------LEQHLHSAPCMLAAAEGTQFSDAGEEDE 62

  Fly    86 PSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRR---CTSND 147
            ....:..:||...|||        :..|.|......|:...|.   .:.:.|.:...   ...:.
  Rat    63 EEEGEKLSYLNSLAAA--------EGHGVSGLCPQSYVHTVLR---DSCSGPKEQEEEVVSERSQ 116

  Fly   148 SDCDSPPPLSSSPSESPLSHDG---SGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMA 209
            ..|.....|.:: .:...|.||   ...||:| .|..||.||||||||||.||||||.|||..:|
  Rat   117 KSCQLKKSLEAA-GDCKASEDGERPKPRSRRK-PRVLFSQAQVFELERRFKQQRYLSAPEREHLA 179

  Fly   210 KSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGA------SKRVPVQVLVRED---------- 258
            .||:||.|||||||||||||.||:  :|.::..||.      .:||.|.||||:.          
  Rat   180 SSLKLTSTQVKIWFQNRRYKCKRQ--RQDKSLELGTHAPPPPPRRVAVPVLVRDGKPCVTPSAQA 242

  Fly   259 -------GSTTYAHMAAPGAGHG 274
                   |:..|::.:.|..|:|
  Rat   243 YGSPYGVGAGAYSYNSFPAYGYG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 40/52 (77%)
Nkx2-3NP_001101064.1 Homeobox 148..202 CDD:395001 40/53 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.