Sequence 1: | NP_732637.1 | Gene: | bap / 42537 | FlyBaseID: | FBgn0004862 | Length: | 382 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571518.2 | Gene: | pdx1 / 30721 | ZFINID: | ZDB-GENE-990415-122 | Length: | 246 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 61/201 - (30%) |
---|---|---|---|
Similarity: | 89/201 - (44%) | Gaps: | 48/201 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 54 PSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPS----ARQP--SNYLQYYAAAMDN--NNHHH- 109
Fly 110 -QATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSP-PPLSSSPSESPLSHDGSG- 171
Fly 172 --------LSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRY 228
Fly 229 KTKRKQ 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bap | NP_732637.1 | Homeobox | 178..231 | CDD:278475 | 27/52 (52%) |
pdx1 | NP_571518.2 | Homeobox | 140..193 | CDD:278475 | 27/52 (52%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |