DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nkx3-1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001029316.1 Gene:Nkx3-1 / 305999 RGDID:1305369 Length:238 Species:Rattus norvegicus


Alignment Length:294 Identity:95/294 - (32%)
Similarity:134/294 - (45%) Gaps:96/294 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MESAGVS--AAMAGLSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSP 66
            :|:.|.|  ||....||.||: |.|.||| |.:.|.|     ..:|.                  
  Rat    12 LEAGGRSPWAAPPTQSKRLTS-FLIQDIL-RDHAERR-----GGQPS------------------ 51

  Fly    67 PLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFG 131
                        |...:.||..::.|      |:.:|      :|.|:|                
  Rat    52 ------------TPQHQCQPDPKRDS------ASELD------EAEGSS---------------- 76

  Fly   132 STL-------AAPLDMRRCTSNDS-------DCDSPPPLSSSP--SESPLSHDGSGLSRKKRSRA 180
            .||       ::|.:.|..|.:|:       ||:..|.|||:|  ::.|          :|||||
  Rat    77 VTLEDPPGIRSSPTETRAETESDAHFETYLLDCEHTPVLSSAPQVTKQP----------QKRSRA 131

  Fly   181 AFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGA 245
            ||||.||.||||:|:.|:|||.|||:.:||:|:|||||||||||||||||||:|:.:....|   
  Rat   132 AFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRRQLSEDLGVL--- 193

  Fly   246 SKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPAL 279
            .|...:.:...:|.|.:.|.:.:..|.:...|.|
  Rat   194 EKNSTLSLPTLKDDSLSRASLVSVYASYPYYPYL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 40/52 (77%)
Nkx3-1NP_001029316.1 Homeobox 129..182 CDD:278475 40/52 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003099
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.