DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and vsx1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571408.1 Gene:vsx1 / 30598 ZFINID:ZDB-GENE-990415-205 Length:344 Species:Danio rerio


Alignment Length:305 Identity:66/305 - (21%)
Similarity:108/305 - (35%) Gaps:112/305 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TRRMSSVDSEPEPEKLKPS--SDRER---SISKSPPLCCRD-LGLYKLTQPKEIQP--------- 86
            |.|..:.|.:|: .||.||  .|:.|   |..:|......| |||....||.:..|         
Zfish     2 TGREEATDEKPK-VKLYPSFGIDKSRLNGSGFRSKGFAITDLLGLESELQPHQSGPGAGPNGEGQ 65

  Fly    87 ------------------------SARQPSN---YLQYYAAAMDNNNHHHQATGTSNSSAADYMQ 124
                                    :|:||..   :|..:...:.:....|            :||
Zfish    66 SAAVGGFSFPGGSLPLGLGFLCSLAAQQPPGAPCFLPSHIPLLQSRTESH------------FMQ 118

  Fly   125 RKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKK-RSRAAFSHAQVF 188
            .            |:.:|...:|.||     ||...::.  .:.|:...||| |.|..|:..|:.
Zfish   119 N------------LEQQRDVYSDDDC-----LSGDRNDG--KNSGNSQKRKKRRHRTVFTSHQLE 164

  Fly   189 ELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQV 253
            |||:.|.:..|.....|..:|....|.|.::::||||||.|.::::.....::::          
Zfish   165 ELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVM---------- 219

  Fly   254 LVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQ 298
                             |.:||..|::   ||       .:|||:
Zfish   220 -----------------AEYGLYGAMV---RH-------SIPLPE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 19/52 (37%)
vsx1NP_571408.1 Octapeptide motif 37..44 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..70 3/20 (15%)
COG5576 101..>221 CDD:227863 35/177 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..156 10/35 (29%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:11331779 147..151 1/3 (33%)
Homeobox 154..207 CDD:278475 19/52 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.