DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and msx2b

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571351.3 Gene:msx2b / 30531 ZFINID:ZDB-GENE-980526-492 Length:241 Species:Danio rerio


Alignment Length:307 Identity:70/307 - (22%)
Similarity:109/307 - (35%) Gaps:119/307 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PFSINDILT--RSNPE-TRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYK--LTQPK 82
            |||:..:::  ::|.: .||...|.|:....:::.|              |...|:.|  :.|..
Zfish    27 PFSVESLISSHKTNKDFERRREDVSSQFAQTEIRDS--------------CGSAGIPKHFMLQTS 77

  Fly    83 EIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSND 147
            .::..:.:|.:...:..     |:.:.|                                 |..:
Zfish    78 PVKSESPEPDDCTSWVM-----NSRYSQ---------------------------------TRQE 104

  Fly   148 SDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSL 212
            |.|    ||....:             .::.|..|:.:|:..|||:|.|::|||..||:|.:.||
Zfish   105 SPC----PLRKHKT-------------NRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSL 152

  Fly   213 RLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDP 277
            .||||||||||||||.|.||.|..:.|...|.|.                              |
Zfish   153 TLTETQVKIWFQNRRAKAKRLQEAELEKLKLTAK------------------------------P 187

  Fly   278 ALINIYRHQLQLAYGGLPLP---QMQMPFPYF---YPQHKVPQPIPP 318
            ||...:         .||||   |:......:   ||..:...|:.|
Zfish   188 ALHPNF---------SLPLPLGTQLHSAVSLYGQSYPYQRPLLPVAP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 31/52 (60%)
msx2bNP_571351.3 Homeobox 118..171 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.