DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and hoxd4a

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001119917.1 Gene:hoxd4a / 30329 ZFINID:ZDB-GENE-980526-214 Length:256 Species:Danio rerio


Alignment Length:214 Identity:58/214 - (27%)
Similarity:77/214 - (35%) Gaps:48/214 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ETRRMSSVDSEPEPEKLKPSSDRE--------RSISKSPPLCCRDLGLYKLTQPKEIQPSARQPS 92
            |....:|...|..|....||.|.:        ||.....|..|           ..:|.|:.||.
Zfish    41 EEYSQNSYIPEQSPGYYSPSQDTDFQHPGIYSRSNYSEQPYSC-----------STVQGSSVQPR 94

  Fly    93 NYLQYYAAA---MDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAP------LDMRRCTSNDS 148
            .::|..|:.   .........|...|.|......|......|.....|      :.....|:.:.
Zfish    95 GHVQDQASTPSPFPAQTEQCPAVQISGSRTGGQQQNTKTQNGIPTKQPAVVYPWMKKVHVTTVNP 159

  Fly   149 DCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLR 213
            |...|.|                    ||||.|::..||.|||:.|...|||:...|.|:|.:|.
Zfish   160 DYTGPEP--------------------KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLC 204

  Fly   214 LTETQVKIWFQNRRYKTKR 232
            |:|.|:||||||||.|.|:
Zfish   205 LSERQIKIWFQNRRMKWKK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 28/52 (54%)
hoxd4aNP_001119917.1 Homeobox 169..222 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.