DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nkx2-8

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001100202.1 Gene:Nkx2-8 / 299061 RGDID:1310629 Length:234 Species:Rattus norvegicus


Alignment Length:196 Identity:69/196 - (35%)
Similarity:89/196 - (45%) Gaps:55/196 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 AAPLDMRRC---TSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQ 196
            ||.|:..|.   :|::|..::.|..||..:....:..||...::::.|..||.||..||||||.|
  Rat    38 AAWLESERSHYPSSDESGLETSPADSSQLASLGRASPGSDAEKRRKRRVLFSKAQTLELERRFRQ 102

  Fly   197 QRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR-------------KQIQQHEAALLGASKR 248
            |||||.|||.::|:.||||.|||||||||.|||.||             .....|.|.  |..:|
  Rat   103 QRYLSAPEREQLARLLRLTPTQVKIWFQNHRYKLKRGRAPGVTESSDVTASADLHAAP--GLLRR 165

  Fly   249 VPVQVLVRE-----------------------------DGSTTYAHMAAPGAGHGLDPALINIYR 284
            |.|.|||.:                             .|.|.:    .||:..||.||    |:
  Rat   166 VVVPVLVHDRSPCNGRGEGTAAVPQDKCSSRLATACPVQGYTAF----GPGSALGLFPA----YQ 222

  Fly   285 H 285
            |
  Rat   223 H 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 37/52 (71%)
Nkx2-8NP_001100202.1 Homeobox 84..137 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D450160at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.