Sequence 1: | NP_732637.1 | Gene: | bap / 42537 | FlyBaseID: | FBgn0004862 | Length: | 382 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001100202.1 | Gene: | Nkx2-8 / 299061 | RGDID: | 1310629 | Length: | 234 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 69/196 - (35%) |
---|---|---|---|
Similarity: | 89/196 - (45%) | Gaps: | 55/196 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 135 AAPLDMRRC---TSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQ 196
Fly 197 QRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR-------------KQIQQHEAALLGASKR 248
Fly 249 VPVQVLVRE-----------------------------DGSTTYAHMAAPGAGHGLDPALINIYR 284
Fly 285 H 285 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bap | NP_732637.1 | Homeobox | 178..231 | CDD:278475 | 37/52 (71%) |
Nkx2-8 | NP_001100202.1 | Homeobox | 84..137 | CDD:278475 | 37/52 (71%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0842 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D450160at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |