DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Otp

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001093993.1 Gene:Otp / 294640 RGDID:727945 Length:325 Species:Rattus norvegicus


Alignment Length:256 Identity:67/256 - (26%)
Similarity:106/256 - (41%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 GSTLAAPLDMRRCTSNDS-------DCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVF 188
            |:||....|:....|..:       |.|..|.....|:.|..... .|..::||.|..|:.||:.
  Rat    54 GATLLPGEDITTVGSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQ-QGQQKQKRHRTRFTPAQLN 117

  Fly   189 ELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQV 253
            ||||.||:..|.....|.|:|..:.|||::|::||||||.|.|:::...:.....|        .
  Rat   118 ELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPG--------T 174

  Fly   254 LVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLP-LPQMQMPFPYFYPQHKVPQPI- 316
            |:...|...:...||..|. .:..:|.:.:.:..:.|...:| :.|:.:| |....|..:.|.: 
  Rat   175 LLPTPGLPQFPSAAAAAAA-AMGDSLCSFHANDTRWAAAAMPGVSQLPLP-PALGRQQAMAQSLS 237

  Fly   317 -------PPPTQ---SSSFVTASSAS----------SSPVPIPIPGAVRPQRTP--CPSPN 355
                   |||..   |:|...::.|.          ...||..:||......:|  |.||:
  Rat   238 QCSLAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPASLPGPSNVSGSPQLCSSPD 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 25/52 (48%)
OtpNP_001093993.1 Homeobox 107..156 CDD:395001 22/48 (46%)
OAR 303..320 CDD:397759
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.