DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Hmx2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001099773.1 Gene:Hmx2 / 293538 RGDID:1565366 Length:273 Species:Rattus norvegicus


Alignment Length:340 Identity:89/340 - (26%)
Similarity:125/340 - (36%) Gaps:117/340 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLNMESAGVSAAMAGLSKSLTTPFSINDIL----------TRSNPETRRMSSVDS-EPEPEK--- 51
            |.:.|..|.....||...|    |:|..||          ....|..:|..||.| |.|||:   
  Rat     1 MGSKEDVGKGCPAAGGVSS----FTIQSILGGGPSEAPREPAGWPARKRSLSVSSEEEEPEEGWK 61

  Fly    52 ------LKPSSDRERSISKSPPLCCRDLGLYKLTQPK---EIQPSARQPSNYLQYYAAAMDNNNH 107
                  ..|...:|.|....||:....||     .||   ...|:|.:.:.:|            
  Rat    62 APACYCPDPHGPKEPSPKHHPPIPFPCLG-----TPKGSGGAGPAASERTPFL------------ 109

  Fly   108 HHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGL 172
                    :.|..|:.:.|.....                         :.|||..|......|.
  Rat   110 --------SPSHPDFKEEKERLLP-------------------------AGSPSPGPERPRDGGA 141

  Fly   173 SR-----KKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR 232
            .|     ||::|..||.:||::||..|..:||||..||:.:|.||:|||||||.||||||.|.||
  Rat   142 ERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKR 206

  Fly   233 KQIQQHEAALL---GASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGL 294
            :...:.|||.:   .|...|.:.::.|                   |.:|:.:            
  Rat   207 QLSAELEAANMAHASAQTLVGMPLVFR-------------------DSSLLRV------------ 240

  Fly   295 PLPQ-MQMPFPYFYP 308
            |:|: :..|.|.:||
  Rat   241 PVPRSLAFPAPLYYP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 31/52 (60%)
Hmx2NP_001099773.1 Homeobox 152..206 CDD:395001 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.