DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Hmx3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001099772.1 Gene:Hmx3 / 293537 RGDID:1559927 Length:356 Species:Rattus norvegicus


Alignment Length:380 Identity:105/380 - (27%)
Similarity:136/380 - (35%) Gaps:144/380 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SSVDSEPEPEKLKPSSDRERSISKSPPLCCRDL--GLYKLTQPKEIQPSAR---QPSNYLQYYAA 100
            |:...:|.|:...|         |..|...|:|  |.:....||. ||..|   .|::.....||
  Rat    13 SAPPPQPPPQPPAP---------KESPFSIRNLLNGDHHRPPPKP-QPPPRTLFAPASAAAAAAA 67

  Fly   101 --------AMDNNNHHHQATGTSNSSAAD------------------YMQRKLAYF--------G 131
                    |::.      |.|.:.|...|                  |::|..|::        |
  Rat    68 AAAAAAKGALEG------AAGFALSQVGDLAFPRFEIPAQRFALPAHYLERSPAWWYPYTLTPAG 126

  Fly   132 STLAAPLDMRRCTSNDS------DCDSPPPL-----------SSSPSE----------------- 162
            ..|..|....:....||      |.|||.||           |.||.|                 
  Rat   127 GHLPRPEASEKALLRDSSPASGTDRDSPDPLLKADPDHKELDSKSPDEIILEESDSEEGKKEGEA 191

  Fly   163 --------------SPLSHDGSG---------LSRKKRSRAAFSHAQVFELERRFAQQRYLSGPE 204
                          :|.|.|...         ..|||::|..||.:|||:||..|..:||||..|
  Rat   192 VPGAAGTTVGATAATPGSEDWKAGADSPEKKPACRKKKTRTVFSRSQVFQLESTFDMKRYLSSSE 256

  Fly   205 RSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALL---GASKRVPVQVLVREDGSTTYAHM 266
            |:.:|.||.||||||||||||||.|.||:...:.|||.|   .|.:.|.|.:|..|:.       
  Rat   257 RAGLAASLHLTETQVKIWFQNRRNKWKRQLAAELEAANLSHAAAQRIVRVPILYHENS------- 314

  Fly   267 AAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQ----MPFPYFYPQHKVPQPIP 317
            ||.||.                 |..|.|:|..|    .|.|.:| .|.|...:|
  Rat   315 AAEGAA-----------------AAAGAPVPVSQPLLTFPHPVYY-SHPVVSSVP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 33/52 (63%)
Hmx3NP_001099772.1 Homeobox 230..284 CDD:395001 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.