DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and ind

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:287 Identity:72/287 - (25%)
Similarity:107/287 - (37%) Gaps:99/287 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAGVSAAMAGLSK---------SLTTPFSINDILTRSNPETRRMSS---------VDSEPEPEKL 52
            :|..:||.|.|.:         ||..|::   .|..|..::...|:         :.:.|..::|
  Fly    82 AAAAAAAAAALQQHPHVSSSPGSLYHPYA---QLFASKRKSSGFSNYEGCYPSPPLSANPNSQQL 143

  Fly    53 KPSSDRERSISKSPPLCCRDLGLYKLTQPKEI--QPSARQPSNYLQYYAAAMDNNNHHHQATGTS 115
            .|.    .::..||.     :|...|.:|...  .|||..        :|::|..|:..:..|  
  Fly   144 PPI----HNLYGSPV-----VGGLPLPEPGSFCTSPSASS--------SASLDYTNNFDEPQG-- 189

  Fly   116 NSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSG--------- 171
                                      :...::|.|        ||:.|||.:..||         
  Fly   190 --------------------------KRFKHESSC--------SPNSSPLKNHSSGGPVEITPLI 220

  Fly   172 ---LSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRK 233
               ....||.|.||:..|:.||||.|:...|||...|.|:|..|||:|.||||||||||.|.|: 
  Fly   221 NDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK- 284

  Fly   234 QIQQHEAALLGASKRVPVQVLVREDGS 260
                      |.|:.....:....:||
  Fly   285 ----------GGSESPTFNLSTNSNGS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 30/52 (58%)
indNP_996087.2 Homeobox 231..283 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.