DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Tlx3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_036012630.1 Gene:Tlx3 / 27140 MGIID:1351209 Length:338 Species:Mus musculus


Alignment Length:139 Identity:46/139 - (33%)
Similarity:68/139 - (48%) Gaps:45/139 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 PPPLSSS----PSESPLSHDGSGLS---------------------------------------- 173
            ||||.|:    ||...:|..| ||:                                        
Mouse   148 PPPLPSALPAMPSVPTVSSLG-GLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTPP 211

  Fly   174 RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQH 238
            ::|:.|.:||..|:.|||:||.:|:||:..||:.:||||::|:.|||.||||||.|.:|:..::.
Mouse   212 KRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEER 276

  Fly   239 EAALLGASK 247
            ||....||:
Mouse   277 EAERQQASR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 29/52 (56%)
Tlx3XP_036012630.1 PRK07764 <20..>109 CDD:236090
Homeobox 216..270 CDD:395001 29/53 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.