DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Prop1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_705891.1 Gene:Prop1 / 266738 RGDID:628759 Length:223 Species:Rattus norvegicus


Alignment Length:199 Identity:58/199 - (29%)
Similarity:86/199 - (43%) Gaps:33/199 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LSSSPSESPLSH---DGSGLSR------------KKRSRAAFSHAQVFELERRFAQQRYLSGPER 205
            |.|:...||.:.   .|:||.|            ::|.|..|:.||:.:||..|.:.:|.....|
  Rat    32 LISTVDRSPETSKRLSGTGLGRPKLCPQRGRPHSRRRHRTTFNPAQLGQLESAFGRNQYPDIWVR 96

  Fly   206 SEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQV---LVREDGSTTYAHMA 267
            ..:|:...|:|.::::||||||.| :|||    |.:||..:..:....   .:.|.....|.:..
  Rat    97 EGLAQDTGLSEARIQVWFQNRRAK-QRKQ----ERSLLQPTAHLSPATFSGFLSESSPYPYTYTT 156

  Fly   268 APGAGHGLDPALINIYRHQL--QLAYG-GLPLP-QMQMPFPYFYPQH--KVPQPIPPPTQSSSFV 326
            .|..    .|...:.|.|.|  |...| .|.|| |.:..:|..:|.|  .:..|.|||..|.|..
  Rat   157 PPPP----VPCFPHPYNHALPSQPCTGASLTLPAQPEDWYPTLHPTHTGHLACPPPPPMFSLSLE 217

  Fly   327 TASS 330
            |..|
  Rat   218 TPKS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 19/52 (37%)
Prop1NP_705891.1 Homeobox 69..123 CDD:395001 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.