DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and VAX2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_036608.1 Gene:VAX2 / 25806 HGNCID:12661 Length:290 Species:Homo sapiens


Alignment Length:288 Identity:85/288 - (29%)
Similarity:120/288 - (41%) Gaps:71/288 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 DNNNHH-HQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLS 166
            |...|. .:..|||.||.|          ||         |.:..||| ..|.|..:......|.
Human    37 DGGGHSPTEVAGTSASSPA----------GS---------RESGADSD-GQPGPGEADHCRRILV 81

  Fly   167 HDGSG------------LSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQV 219
            .|..|            |.|.||:|.:|:..|::.||..|.:.:|:.|.||:|:|:.|.|:||||
Human    82 RDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQV 146

  Fly   220 KIWFQNRRYKTKRKQIQQHE-AALLGASKRVPVQVLVR--EDGSTTYAHMAAPGAGHGLDPALIN 281
            |:||||||.|.|:.|.:..| .|...||:......::|  |.|..    ::.|.|     |:|: 
Human   147 KVWFQNRRTKQKKDQSRDLEKRASSSASEAFATSNILRLLEQGRL----LSVPRA-----PSLL- 201

  Fly   282 IYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSS-PVPIPIPGAVR 345
                .|..:..|||            ..|:......|...|......||||:| |:|.|:|..  
Human   202 ----ALTPSLPGLP------------ASHRGTSLGDPRNSSPRLNPLSSASASPPLPPPLPAV-- 248

  Fly   346 PQRTPCPSPNGQMMSVESGAESVHSAAE 373
                 |.| :..::.:.:|.|...||.|
Human   249 -----CFS-SAPLLDLPAGYELGSSAFE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
VAX2NP_036608.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 16/57 (28%)
Homeobox 105..158 CDD:306543 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..240 11/46 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.