DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and ALX3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_006483.2 Gene:ALX3 / 257 HGNCID:449 Length:343 Species:Homo sapiens


Alignment Length:363 Identity:96/363 - (26%)
Similarity:139/363 - (38%) Gaps:97/363 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 MSSVDSEPEPE-------KLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQY 97
            ::|.|..|.|:       .|.|:..|...:::.|  .|..|..| |.:|      |:.|:.|||.
Human    19 VASGDEPPGPQGTPAAAPHLHPAPPRGPRLTRFP--ACGPLEPY-LPEP------AKPPAKYLQD 74

  Fly    98 YAAAMD-NNNHHHQATGTS---NSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSS 158
            ...... |..|.::....:   .|.||.:.|           .|||.|     ....|.|..|..
Human    75 LGPGPALNGGHFYEGPAEAEEKTSKAASFPQ-----------LPLDCR-----GGPRDGPSNLQG 123

  Fly   159 SPS------ESPLSHDGSGL----------SRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSE 207
            ||.      ..|||   .||          |:|:|:|..||..|:.|||:.|.:..|.....|.:
Human   124 SPGPCLASLHLPLS---PGLPDSMELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQ 185

  Fly   208 MAKSLRLTETQVKIWFQNRRYKTKRKQ----IQQHEAALLGASKRVPVQVLVREDGSTTYAH--M 266
            :|....|||.:|::||||||.|.::::    ||:.......|   ..:.||.|.|......:  .
Human   186 LALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAA---YDISVLPRTDSHPQLQNSLW 247

  Fly   267 AAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHK------VPQP---------- 315
            |:||:|....|.|:         :..|:|.|.|.   ||.:|...      ||.|          
Human   248 ASPGSGSPGGPCLV---------SPEGIPSPCMS---PYSHPHGSVAGFMGVPAPSAAHPGIYSI 300

  Fly   316 --IPPPTQSSSFVTASSAS-SSPVPIPIPGAVRPQRTP 350
              .||.....||..:|... .||..:.:  .|:|:..|
Human   301 HGFPPTLGGHSFEPSSDGDYKSPSLVSL--RVKPKEPP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 22/52 (42%)
ALX3NP_006483.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 23/93 (25%)
PRK12323 <13..131 CDD:237057 33/136 (24%)
Homeobox 157..210 CDD:365835 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.