DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nkx2-1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006240178.1 Gene:Nkx2-1 / 25628 RGDID:3866 Length:423 Species:Rattus norvegicus


Alignment Length:410 Identity:108/410 - (26%)
Similarity:144/410 - (35%) Gaps:148/410 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQ 80
            :|...|||||::|||:                      |..:..:.:..........|..|:   
  Rat    54 MSPKHTTPFSVSDILS----------------------PLEESYKKVGMEGGGLGAPLAAYR--- 93

  Fly    81 PKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTS 145
                |..|..|:..:|.:|.     .||...|...:.:||...|...:..|.         .|..
  Rat    94 ----QGQAAPPAAAMQQHAV-----GHHGAVTAAYHMTAAGVPQLSHSAVGG---------YCNG 140

  Fly   146 NDSDCDSPPPLSSS-------------------PSESPLSHDGSGLS------------------ 173
            |..:....||...:                   |:.|......||::                  
  Rat   141 NLGNVSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMA 205

  Fly   174 ------RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR 232
                  |:|| |..||.|||:||||||.||:|||.|||..:|..:.||.|||||||||.|||.||
  Rat   206 PLPSAPRRKR-RVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 269

  Fly   233 --------KQIQ----------------QHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGA-- 271
                    :|:|                |.:.|...:.:||.|.|||: ||....|...||||  
  Rat   270 QAKDKAAQQQLQQDSGGGGGGGGGAGCPQQQQAQQQSPRRVAVPVLVK-DGKPCQAGAPAPGAAS 333

  Fly   272 --GHGLDPALINIYRHQLQLAY----------GGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSS 324
              ||....|     :.|.|.|.          ||..|..        :|.|:      |.:...|
  Rat   334 LQGHAQQQA-----QQQAQAAQAAAAAISVGSGGAGLGA--------HPGHQ------PGSAGQS 379

  Fly   325 FVTASSASSSPVPIPIPGAV 344
            ...|..|:|   |..:.|.|
  Rat   380 PDLAHHAAS---PAALQGQV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 35/52 (67%)
Nkx2-1XP_006240178.1 Homeobox 215..268 CDD:278475 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.