DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Msx2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_037114.2 Gene:Msx2 / 25483 RGDID:3116 Length:267 Species:Rattus norvegicus


Alignment Length:328 Identity:82/328 - (25%)
Similarity:117/328 - (35%) Gaps:122/328 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLG--LYKLTQ 80
            |..:.|||:..::              |:.:|.|..|:         .|| .|...|  |..|..
  Rat    41 KVSSLPFSVEALM--------------SDKKPPKESPA---------VPP-DCASAGAVLRPLLL 81

  Fly    81 PKEIQPSARQPSNYLQ-YYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCT 144
            |......|..|...:: :..|::.:.|         :...|.::|....|               
  Rat    82 PGHGVRDAHSPGPLVKPFETASVKSEN---------SEDGAPWIQEPGRY--------------- 122

  Fly   145 SNDSDCDSPPPLSSSPSESPL-SHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEM 208
                   ||||...||:...| .|     ...::.|..|:.:|:..|||:|.|::|||..||:|.
  Rat   123 -------SPPPRHMSPTTCTLRKH-----KTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEF 175

  Fly   209 AKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGH 273
            :.||.||||||||||||||.|.||.|..:.|...:.|...:|                    :|.
  Rat   176 SSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLP--------------------SGF 220

  Fly   274 GLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPI 338
            .|                                     |.||..|.|::|..:||.....|| :
  Rat   221 SL-------------------------------------PFPINSPLQAASIYSASYPFHRPV-L 247

  Fly   339 PIP 341
            |||
  Rat   248 PIP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 31/52 (60%)
Msx2NP_037114.2 Homeobox 145..199 CDD:395001 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.