DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Drgx

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_665710.2 Gene:Drgx / 252880 RGDID:628616 Length:263 Species:Rattus norvegicus


Alignment Length:275 Identity:69/275 - (25%)
Similarity:105/275 - (38%) Gaps:77/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 PPPLSSSPSESPLSHDGSG------LSRK-KRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAK 210
            ||.|..:   :|..:..:|      |.|| :|:|..|:..|:..||..|||..|.....|.|:|.
  Rat     7 PPQLEGT---APFGNHSTGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAM 68

  Fly   211 SLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVP------VQVL---VREDGS------ 260
            .:.|||.:|::||||||.|.::.:        .|||.:.|      .:|.   ||...|      
  Rat    69 KINLTEARVQVWFQNRRAKWRKTE--------RGASDQEPGAKEPMAEVTPPPVRNINSPPPGDQ 125

  Fly   261 ---TTYAHMAAPGAGHGLDPA-----------LINIYRHQLQLAY-----GGLPLPQMQMPFPY- 305
               ...|..|....|..:.||           |:|...:...|::     || ||....:|.|. 
  Rat   126 ARGKKEALEAQQSLGRTVGPAGPFFPSCLPGTLLNTATYAQALSHVASLKGG-PLCSCCVPDPMG 189

  Fly   306 --FYPQH---------------KVPQPIPPPTQSSSFVTASSASSSPVPIPIPGAVRPQRTPCPS 353
              |.|.:               |..:......||::.:.::|:|..|....:|......:   ||
  Rat   190 LSFLPTYGCQSNRTASVAALRMKAREHSEAVLQSANLLPSTSSSPGPASKQVPPEGSQDK---PS 251

  Fly   354 PNGQMMSVESGAESV 368
            |..:.   ..|.:||
  Rat   252 PTKEQ---SEGEKSV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 23/52 (44%)
DrgxNP_665710.2 Homeobox 37..90 CDD:395001 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..135 9/54 (17%)
OAR 201..218 CDD:397759 1/16 (6%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 204..217 1/12 (8%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..263 10/49 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.