DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Obox3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_663753.3 Gene:Obox3 / 246791 MGIID:2149032 Length:335 Species:Mus musculus


Alignment Length:257 Identity:56/257 - (21%)
Similarity:106/257 - (41%) Gaps:39/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 QRKLAYFGSTLAAPLDMRRCTSNDSDCDSPP------PLSS---SPSESPLSHDGSGLSRKKRSR 179
            |..|...|||:.:.|.:........:...|.      |||.   :....|::     |.:.::.|
Mouse    39 QNPLMTPGSTMQSRLSVPERNLLQQESQGPTRQSGRMPLSDRYVNKQTGPMA-----LRKFRKER 98

  Fly   180 AAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAAL-- 242
            ..:|..|...|::.|.:.:|.:..:..|:|.|:.:|:.::||||:|.|.|.:|.::|..:.||  
Mouse    99 TVYSKEQQCLLQKHFDEFQYPNEKKIVELALSVGVTKREIKIWFKNNRAKYRRMKLQNIKQALPE 163

  Fly   243 -------LGASKRVP--VQVLVREDG----STTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGL 294
                   :..|...|  :.|:..::|    |.|:...:.|......:.:|     |..|...|.:
Mouse   164 TNESSKAVSESTHFPGSIPVVDSDNGESMCSGTFGEDSIPKLNCSQESSL-----HCFQACDGDM 223

  Fly   295 PLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIPGAVR-PQRT----PC 351
            ..||....:..:......|.......||::|.:.:..:.:.||:.:..|.: |:..    ||
Mouse   224 CCPQEYQEYQEYLLHGHAPVTAWNSGQSAAFESQTDLAVAEVPVGLAYAAQAPEDAHNSGPC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 17/52 (33%)
Obox3NP_663753.3 homeodomain 95..153 CDD:238039 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.