DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Bsx

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_839976.1 Gene:Bsx / 244813 MGIID:2669849 Length:232 Species:Mus musculus


Alignment Length:263 Identity:75/263 - (28%)
Similarity:104/263 - (39%) Gaps:81/263 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SKSLTTPFSINDILTRSNPETRRMSSVDSEPEP-EKLKPSSDRERSISKSPPLCCRDLGLYKLTQ 80
            |....|.|.|.|||..             :|:| .::.|........|:.|.|   |.|...:..
Mouse    13 SSQRPTSFFIEDILLH-------------KPKPLREVAPDHFASSLASRVPLL---DYGYPLMPT 61

  Fly    81 PKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTS 145
            |..:.|.|..|          :...:|||                  .||.:|...|:       
Mouse    62 PTLLTPHAHHP----------LHKGDHHH------------------PYFLTTSGMPV------- 91

  Fly   146 NDSDCDSPPPLSSSP--SESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEM 208
                    |.|...|  :|.|..|     .|::::|..||.:|:..||:||..|||||.|||.|:
Mouse    92 --------PALFPHPQHAELPGKH-----CRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVEL 143

  Fly   209 AKSLRLTETQVKIWFQNRRYKTKR--KQIQQHEAALLG-----ASKRVPVQVLVREDGSTTYAHM 266
            |.:|.|:|||||.||||||.|.|:  ::.|....|..|     .|.|.|       :|:...|.:
Mouse   144 ATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAADGPESPEGSPRAP-------EGAPADARL 201

  Fly   267 AAP 269
            :.|
Mouse   202 SLP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 32/52 (62%)
BsxNP_839976.1 Homeobox 114..167 CDD:395001 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..232 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.