DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Vax2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_036042.1 Gene:Vax2 / 24113 MGIID:1346018 Length:292 Species:Mus musculus


Alignment Length:250 Identity:71/250 - (28%)
Similarity:112/250 - (44%) Gaps:48/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 HQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSP-SESPLSHDGSG- 171
            |:......:.......|::|  |::.::|...|   .:..|.|....|..:. ....|..|..| 
Mouse    28 HRGAEDLRADTGSASPREIA--GTSASSPAGSR---ESGGDSDGQQALGETDHCRRILVRDAKGT 87

  Fly   172 -----------LSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQN 225
                       |.|.||:|.:|:..|::.||..|.:.:|:.|.||:|:|:.|.|:|||||:||||
Mouse    88 IREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQN 152

  Fly   226 RRYKTKRKQIQQHE-AALLGASKRVPVQVLVR--EDGSTTYAHMAAPGAGHGLDPALINIYRHQL 287
            ||.|.|:.|.:..| .|...||:......::|  |.|..    ::.|.|     |:|:.:     
Mouse   153 RRTKQKKDQSRDLEKRASSSASEAFATSNVLRLLEQGRL----LSVPRA-----PSLLAL----- 203

  Fly   288 QLAYGGLP-LPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIP 341
               ..||| ||..........|::..|:..|.|         |:::|||:|.|:|
Mouse   204 ---TPGLPGLPASHRGTSLVDPRNSSPRLNPMP---------SASASSPLPPPLP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
Vax2NP_036042.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74 9/50 (18%)
Homeobox 105..158 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..242 12/43 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.