DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Gbx1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_056554.1 Gene:Gbx1 / 231044 MGIID:95667 Length:418 Species:Mus musculus


Alignment Length:226 Identity:60/226 - (26%)
Similarity:94/226 - (41%) Gaps:65/226 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TRSNPE--TRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDL-------GLYKLTQPKEIQP 86
            :|||||  .||   .|...:.|:|.|:.::.......||....:.       |....:..::::|
Mouse   189 SRSNPEPAARR---TDGALDAEELLPAREKVTEPPPPPPPHFSETFPSLPAEGKVYSSDEEKLEP 250

  Fly    87 SARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCD 151
            .|..|:...|             :..|:...|...::                       ||...
Mouse   251 PAGDPAGSEQ-------------EEEGSGGDSEDSFL-----------------------DSSAG 279

  Fly   152 SP-------PPLSSSPSESPLSHDGSGLS--------RKKRSRAAFSHAQVFELERRFAQQRYLS 201
            .|       |.|..||...  :.:|:.::        :.:|.|.||:..|:.|||:.|..::|||
Mouse   280 GPGALLGPKPKLKGSPGTG--AEEGTPVATGVTTPGGKSRRRRTAFTSEQLLELEKEFHCKKYLS 342

  Fly   202 GPERSEMAKSLRLTETQVKIWFQNRRYKTKR 232
            ..|||::|.:|:|:|.||||||||||.|.||
Mouse   343 LTERSQIAHALKLSEVQVKIWFQNRRAKWKR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 29/52 (56%)
Gbx1NP_056554.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..320 18/143 (13%)
Homeobox 319..372 CDD:278475 29/52 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.