DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Vax1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_033527.1 Gene:Vax1 / 22326 MGIID:1277163 Length:338 Species:Mus musculus


Alignment Length:299 Identity:76/299 - (25%)
Similarity:116/299 - (38%) Gaps:72/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 AAAMDNNNH--HHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPS 161
            ||.:..|.|  ..:..|...|..|.:::.....|..:.|:           .||:..   .|:.|
Mouse    18 AARVSKNAHKESREIKGAEGSLPAAFLKEPQGAFSGSGAS-----------EDCNKS---KSNSS 68

  Fly   162 ESP------LSHDGSG------------LSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEM 208
            ..|      |..|..|            |.|.||:|.:|:..|::.||..|.:.:|:.|.||:|:
Mouse    69 ADPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTEL 133

  Fly   209 AKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVL-VREDGSTTYAHMAAPGAG 272
            |:.|.|:|||||:||||||.|.|:.|.:..|...:.:.......|| :.|.|..    ::.||..
Mouse   134 ARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCSVLRLLEQGRL----LSPPGLP 194

  Fly   273 HGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVP 337
            ..|.|....    .|..|..|..||                 .:.....:.|...|::|:::..|
Mouse   195 ALLPPCATG----ALGSALRGPSLP-----------------ALGAGAAAGSAAAAAAAAAATAP 238

  Fly   338 IPIPGAVRPQ----RTPCPSPNGQMMSVESGAESVHSAA 372
            .|...|.:.|    ..|.|.|        :|...:|:.|
Mouse   239 GPAGAASQHQPAVGGAPGPGP--------AGPGGLHAGA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
Vax1NP_033527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 12/64 (19%)
Homeobox 103..156 CDD:306543 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..269 8/37 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.