DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and EN2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001418.2 Gene:EN2 / 2020 HGNCID:3343 Length:333 Species:Homo sapiens


Alignment Length:91 Identity:36/91 - (39%)
Similarity:48/91 - (52%) Gaps:9/91 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 CTSNDSDCDSPPPLSSSP-SESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERS 206
            || ..||..|..|.|..| .::|...|       ||.|.||:..|:..|:..|...|||:...|.
Human   219 CT-RYSDRPSSGPRSRKPKKKNPNKED-------KRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQ 275

  Fly   207 EMAKSLRLTETQVKIWFQNRRYKTKR 232
            .:|:.|.|.|:|:||||||:|.|.|:
Human   276 SLAQELSLNESQIKIWFQNKRAKIKK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 23/52 (44%)
EN2NP_001418.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..206
homeobox domain 243..302 27/66 (41%)
Homeobox 247..300 CDD:306543 23/52 (44%)
Engrail_1_C_sig 302..331 CDD:313702 36/91 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.