DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and ceh-28

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_510169.4 Gene:ceh-28 / 191619 WormBaseID:WBGene00000450 Length:201 Species:Caenorhabditis elegans


Alignment Length:190 Identity:58/190 - (30%)
Similarity:76/190 - (40%) Gaps:78/190 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 SSPSESPLSHDG------------SGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAK 210
            ||||::..|:..            ....:|::.|..|:..||.|||.||.:|||::..||.|:|:
 Worm    75 SSPSQNQRSYQNHRQHSNPDTINLRSQQQKRKPRVLFTQHQVNELEERFKKQRYVTATEREELAQ 139

  Fly   211 SLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGL 275
            .|.||.|||||||||||||.||                      :.:|                 
 Worm   140 CLGLTATQVKIWFQNRRYKCKR----------------------LAQD----------------- 165

  Fly   276 DPALINIYRHQLQLAYGGLPLPQMQMPF-PYFYPQHKVPQPIPPPTQSSSFVTASSASSS 334
                     ..|||:         |:|| |.|....        |...:||.||.|:|||
 Worm   166 ---------RTLQLS---------QIPFNPMFASAF--------PFGINSFGTAPSSSSS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 32/52 (62%)
ceh-28NP_510169.4 HOX 104..160 CDD:197696 33/55 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.