DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and T07G12.3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_501945.2 Gene:T07G12.3 / 188242 WormBaseID:WBGene00011594 Length:623 Species:Caenorhabditis elegans


Alignment Length:116 Identity:18/116 - (15%)
Similarity:36/116 - (31%) Gaps:50/116 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LGASKRVPV--------------QVLVREDGSTTYAHM--------AAP---------------- 269
            :|.||.|.:              :.:..||....|.|:        |:|                
 Worm   106 IGGSKNVKIGPWMKPGHVDCEFLETVCWEDNIEVYGHIHTQIIPRKASPTKFKDAPNVFIFTIDA 170

  Fly   270 ---GAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIP 317
               |......|.|::.::::.|:         ::.||.....::..|..:|
 Worm   171 MNTGMAKRSFPKLLSYFKNEFQM---------IEFPFVNKVGENSRPNGLP 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475
T07G12.3NP_501945.2 DUF229 67..538 CDD:281053 18/116 (16%)
ALP_like 161..448 CDD:293745 8/61 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.