powered by:
Protein Alignment bap and T07G12.3
DIOPT Version :9
Sequence 1: | NP_732637.1 |
Gene: | bap / 42537 |
FlyBaseID: | FBgn0004862 |
Length: | 382 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_501945.2 |
Gene: | T07G12.3 / 188242 |
WormBaseID: | WBGene00011594 |
Length: | 623 |
Species: | Caenorhabditis elegans |
Alignment Length: | 116 |
Identity: | 18/116 - (15%) |
Similarity: | 36/116 - (31%) |
Gaps: | 50/116 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 243 LGASKRVPV--------------QVLVREDGSTTYAHM--------AAP---------------- 269
:|.||.|.: :.:..||....|.|: |:|
Worm 106 IGGSKNVKIGPWMKPGHVDCEFLETVCWEDNIEVYGHIHTQIIPRKASPTKFKDAPNVFIFTIDA 170
Fly 270 ---GAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIP 317
|......|.|::.::::.|: ::.||.....::..|..:|
Worm 171 MNTGMAKRSFPKLLSYFKNEFQM---------IEFPFVNKVGENSRPNGLP 212
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0842 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.