DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Pitx2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001035967.1 Gene:Pitx2 / 18741 MGIID:109340 Length:324 Species:Mus musculus


Alignment Length:286 Identity:74/286 - (25%)
Similarity:112/286 - (39%) Gaps:57/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 HQATGTSNSSAAD-YMQRKLAYFGSTLAAPLDMRRCTSND--------SDCDSPPPL-----SSS 159
            |:|.||..|:|:. :.....|...:::.||...|...|:.        ||..||...     ...
Mouse    12 HRAAGTKLSAASSPFCHHPQALAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEVAEKDKGQQG 76

  Fly   160 PSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQ 224
            .:|...:.|.|...|::|.|..|:..|:.|||..|.:.||.....|.|:|....|||.:|::||:
Mouse    77 KNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFK 141

  Fly   225 NRRYK-TKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQ 288
            |||.| .||::.||.|....|...:....:...:|....|::  ...|..||..|.::       
Mouse   142 NRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSY--NNWAAKGLTSASLS------- 197

  Fly   289 LAYGGLPLPQMQMPFPYFYPQHKVP----QPIPPPTQSSSFVTASSASSSPVPIPIPGAVRPQRT 349
                       ...||:|...:..|    ....||...||.    |.|||.||..:.|.      
Mouse   198 -----------TKSFPFFNSMNVNPLSSQSMFSPPNSISSM----SMSSSMVPSAVTGV------ 241

  Fly   350 PCPSPNGQMMSVES----GAESVHSA 371
                |...:.|:.:    .:.|::||
Mouse   242 ----PGSSLNSLNNLNNLSSPSLNSA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 22/53 (42%)
Pitx2NP_001035967.1 COG5576 40..>149 CDD:227863 35/108 (32%)
Homeobox 96..149 CDD:365835 22/52 (42%)
OAR 282..299 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.