DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and K03A11.4

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_510170.2 Gene:K03A11.4 / 186918 WormBaseID:WBGene00010521 Length:664 Species:Caenorhabditis elegans


Alignment Length:321 Identity:56/321 - (17%)
Similarity:99/321 - (30%) Gaps:137/321 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 NYLQYYAAAMDNNNHHHQATGTS--------------NSSAADYM---------QRKLAYFGSTL 134
            ::::.:..|.:..||     |||              :.:..|||         |||   ||...
 Worm   327 HFMRPFQNAYERKNH-----GTSLTQKHLNGKLCRETHHTLLDYMGQFTKAYPDQRK---FGWVW 383

  Fly   135 AAPLDMRRCTSN---DSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVF-------- 188
            |  :|:...|.|   .:|.|....|        :.|           |.|...:.||        
 Worm   384 A--IDLGHNTENGFAHADKDFHNYL--------IKH-----------RKALDESFVFILGDHGLR 427

  Fly   189 --ELERRFAQQRYLSGPERS-EMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVP 250
              ::.:.|.....::.|..: .:.|.||.|...::|..:|      .||||.|            
 Worm   428 FGDVRKTFVGSLDVNNPFTALSIPKVLRKTTKILEIMTEN------AKQIQSH------------ 474

  Fly   251 VQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQP 315
                                  :.....:::|.::|...::                 ...:|:.
 Worm   475 ----------------------YDTRATILDIMKYQSANSF-----------------SETMPRE 500

  Fly   316 IPPPTQSSSFV-----TASSASSSPVPIPIPGAVRPQRTPCPSPNGQMMSVESGAESVHSA 371
            | |..:.||::     |..:..:.|||:        |...|.....::....:.|||:..|
 Worm   501 I-PGEKGSSYIRKQPSTPRNCRNMPVPL--------QYCICQFKKSKLPRNTTTAESIGKA 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 12/63 (19%)
K03A11.4NP_510170.2 DUF229 98..570 CDD:281053 56/321 (17%)
ALP_like 199..488 CDD:293745 40/229 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.