DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and ceh-27

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001256348.1 Gene:ceh-27 / 185853 WormBaseID:WBGene00000449 Length:263 Species:Caenorhabditis elegans


Alignment Length:248 Identity:68/248 - (27%)
Similarity:103/248 - (41%) Gaps:47/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 ATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPL---------- 165
            |..|.:.||......:::||......|.|.....::.:...:|.|:::.|..:..          
 Worm    22 AFSTLSISAPATTAAQMSYFAFPNQYPHDFSSYNTSAAYATAPYPMATHPQLANFNRFQTNQLNL 86

  Fly   166 ---SHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRR 227
               :.....:||:|| |..||..||..|||:|...||||..:|..:|||:.|:.|||||||||:|
 Worm    87 GLTTQQNMMISRRKR-RVLFSPQQVHVLERKFQINRYLSAADRENLAKSINLSATQVKIWFQNQR 150

  Fly   228 YKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYG 292
            ||.||   |:.|..:.|.        ..|:....|.:......:| .|..::..|.:.:.:....
 Worm   151 YKCKR---QEKEKKMDGG--------CYRDSDRDTDSDRDNDSSG-SLGSSMSGIKKEEDEDRKP 203

  Fly   293 GLP---------LPQM-QMPFPY-----------FYPQHKVPQPIPPPTQSSS 324
            .:|         ||.: |..|||           |:.....|...||.|.:.|
 Worm   204 FMPSAVSSDTACLPDISQQAFPYQMYPSSSYMPPFFAYQAPPANYPPSTYNLS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 30/52 (58%)
ceh-27NP_001256348.1 homeodomain 99..157 CDD:238039 34/61 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.