DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Sebox

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_032785.1 Gene:Sebox / 18292 MGIID:108012 Length:190 Species:Mus musculus


Alignment Length:236 Identity:58/236 - (24%)
Similarity:84/236 - (35%) Gaps:89/236 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 PLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQV 219
            |:.:||.      ..|||...:|.|..||..|:.||||.||.:.|.....|..:|:...|.|.::
Mouse     4 PVEASPG------CASGLGPHRRKRTTFSVGQLVELERVFAARPYPDISTREHLAQVTHLPEAKI 62

  Fly   220 KIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYR 284
            ::||||||    .|:|:..:                             |||           ..
Mouse    63 QVWFQNRR----AKRIKDRK-----------------------------PGA-----------LN 83

  Fly   285 HQLQLAYGGLPLPQM-QMPF---PYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIPGAVR 345
            .:|:|......||.. |:|:   ...:|.|        ||.|:.:.:|.                
Mouse    84 SRLELPPNSCSLPDTPQLPWDPGTSSHPLH--------PTSSAQYTSAC---------------- 124

  Fly   346 PQRTPCPSP---NGQMMS--------VESGAESVHSAAEDV 375
            |.:|.|..|   .||..|        ..|||..:||:.|.:
Mouse   125 PPQTSCLGPILGPGQSWSGAKVAAPWGTSGASGIHSSLEQI 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 21/52 (40%)
SeboxNP_032785.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 6/21 (29%)
Homeobox 21..72 CDD:278475 21/54 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..123 14/94 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.