DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nkx3-1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_035051.1 Gene:Nkx3-1 / 18095 MGIID:97352 Length:237 Species:Mus musculus


Alignment Length:319 Identity:100/319 - (31%)
Similarity:132/319 - (41%) Gaps:118/319 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MESAGVS--AAMAGLSKSLTTPFSINDIL-------------TRSNPETRRMSSVDSEPEPEKLK 53
            :|:.|.|  ||....||.||: |.|.|||             .:.:|:.||    ||.|||:|. 
Mouse    12 VEAGGRSPWAAPPTQSKRLTS-FLIQDILRDRAERHGGHSGNPQHSPDPRR----DSAPEPDKA- 70

  Fly    54 PSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSS 118
                ..|.::...|                  ||.|                   |....|....
Mouse    71 ----GGRGVAPEDP------------------PSIR-------------------HSPAETPTEP 94

  Fly   119 AADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFS 183
            .:|      |:|.:.|   ||   |..|..|..|.|.::..|              :||||||||
Mouse    95 ESD------AHFETYL---LD---CEHNPGDLASAPQVTKQP--------------QKRSRAAFS 133

  Fly   184 HAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKR 248
            |.||.||||:|:.|:|||.|||:.:||:|:|||||||||||||||||||||:.:....|   .|.
Mouse   134 HTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSEDLGVL---EKN 195

  Fly   249 VPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFY 307
            .|:.:...:|.|..             ..:|:::|.        ..|.      :||.|
Mouse   196 SPLSLPALKDDSLP-------------STSLVSVYT--------SYPY------YPYLY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 40/52 (77%)
Nkx3-1NP_035051.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 30/130 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..130 8/35 (23%)
Homeobox 128..181 CDD:278475 40/52 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003099
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4480
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.