DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nkx2-9

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_032727.2 Gene:Nkx2-9 / 18094 MGIID:1270158 Length:235 Species:Mus musculus


Alignment Length:185 Identity:70/185 - (37%)
Similarity:91/185 - (49%) Gaps:53/185 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 TSNDSDCDSPP----PLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPE 204
            :|::|..::.|    .|:|...|||    ||...::::.|..||.||..||||||.||||||.||
Mouse    50 SSDESGLETSPADSSQLASLRRESP----GSDPEKRRKRRVLFSKAQTLELERRFRQQRYLSAPE 110

  Fly   205 RSEMAKSLRLTETQVKIWFQNRRYKTKRKQI-------------QQHEAALLGASKRVPVQVLV- 255
            |.::|:.||||.|||||||||.|||.||.:.             ..|.|.  |..:||.|.||| 
Mouse   111 REQLARLLRLTPTQVKIWFQNHRYKLKRGRAPGITEPSDMAASSDLHAAP--GLLRRVVVPVLVH 173

  Fly   256 --------REDGSTTY------AHMA-----------APGAGHGLDPALINIYRH 285
                    |.:|::..      |.:|           .||:..||.||    |:|
Mouse   174 DRPPSNNGRGEGTSAVPQDKCSARLATACPVPGYTAFGPGSALGLFPA----YQH 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 37/52 (71%)
Nkx2-9NP_032727.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..86 10/38 (26%)
Homeobox 84..138 CDD:365835 37/53 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D450160at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.