DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nkx2-6

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_035050.2 Gene:Nkx2-6 / 18092 MGIID:97351 Length:289 Species:Mus musculus


Alignment Length:385 Identity:107/385 - (27%)
Similarity:143/385 - (37%) Gaps:144/385 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TTPFSINDILTR--SNPETRRMSSVDSEPEPEKLKP-------------SSDRERSISKSPPLCC 70
            :||||:.|||..  ...:::.:|..:....|  :||             ||||.:::    |..|
Mouse     8 STPFSVADILRLECQQKDSKTLSQWELHRNP--VKPRYLRMNQESGWFESSDRAQAV----PFRC 66

  Fly    71 R-----DLGLYKLTQPKEIQP------SARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQ 124
            .     ::|...:.:| :..|      .||.|..                 ..|..|.|.     
Mouse    67 TWETVLEMGSNPVGEP-QTPPGTISRLGARNPMT-----------------DRGVGNLSG----- 108

  Fly   125 RKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFE 189
                          ||||        ..|....:.|              :::||..||.|||..
Mouse   109 --------------DMRR--------GGPVSTRTRP--------------QRKSRVLFSQAQVLA 137

  Fly   190 LERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLG---ASKRVPV 251
            |||||.|||||:.|||..:|.:|:||.|||||||||||||:| .|.|.....|.|   |.:||.|
Mouse   138 LERRFKQQRYLTAPEREHLASALQLTSTQVKIWFQNRRYKSK-SQRQDQTLELAGHPLAPRRVAV 201

  Fly   252 QVLVREDGSTTYAHMAAPGAGHGLDP---ALINIYRHQLQLA-YGGLPLPQMQMPFPYFYPQHKV 312
            .|||. ||...            |||   |.:..|:.....: :||    ....|:...|     
Mouse   202 PVLVL-DGKPC------------LDPDVAAFLGPYKATSPYSCFGG----YAGTPYDASY----- 244

  Fly   313 PQPIPPPTQSSSFVTASSASSSPVPIPIPGAVRPQRTPCPSPNGQMMSVESGAESVHSAA 372
                      :|..|::||.        ||.:.|..:...||.||     |.|...|..|
Mouse   245 ----------ASRCTSASAG--------PGPLTPLASSGFSPGGQ-----SAAPQGHLPA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 37/52 (71%)
Nkx2-6NP_035050.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..125 15/108 (14%)
Homeobox 126..179 CDD:278475 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..289 9/28 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.