DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and mec-3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001023111.1 Gene:mec-3 / 177938 WormBaseID:WBGene00003167 Length:321 Species:Caenorhabditis elegans


Alignment Length:184 Identity:35/184 - (19%)
Similarity:64/184 - (34%) Gaps:46/184 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGST 133
            ||...|.:.....:.:........:.:.:|...||:|     |.|...|:               
 Worm   117 CCSLCGRHLSPGEQILVDDTMMTVSCMSHYPPQMDDN-----APGAIGSA--------------- 161

  Fly   134 LAAPLDMRRCTSNDSDCDSPPPLSSSPSE--------------------SPLSHDGSGLSRKKRS 178
                :|:..|::.:.  .:|.|:..|.|.                    |....|.|.:.:::..
 Worm   162 ----VDIPSCSTENP--IAPYPIDESFSSAFQVKKEVDAYGYNFEHYSFSDFCDDDSRMLKRRGP 220

  Fly   179 RAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR 232
            |......|:..|...|:.....|...|:::|....|:...:::||||||.|.:|
 Worm   221 RTTIKQNQLDVLNEMFSNTPKPSKHARAKLALETGLSMRVIQVWFQNRRSKERR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 15/52 (29%)
mec-3NP_001023111.1 LIM 29..84 CDD:278823
LIM 89..135 CDD:295319 3/17 (18%)
Homeobox 220..273 CDD:278475 15/52 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.