DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and NKX2-3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_660328.2 Gene:NKX2-3 / 159296 HGNCID:7836 Length:364 Species:Homo sapiens


Alignment Length:294 Identity:91/294 - (30%)
Similarity:128/294 - (43%) Gaps:74/294 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQ 85
            :||||:.|||   |.|.:......:..:       :|.|.....:|.:.....|.......:|.:
Human     9 STPFSVKDIL---NLEQQHQHFHGAHLQ-------ADLEHHFHSAPCMLAAAEGTQFSDGGEEDE 63

  Fly    86 PSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLD----------- 139
            ....:..:||...|||   :.|     |.|......|:...|.   .:.:.|.:           
Human    64 EDEGEKLSYLNSLAAA---DGH-----GDSGLCPQGYVHTVLR---DSCSEPKEHEEEPEVVRDR 117

  Fly   140 ------MRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQR 198
                  :::......||.     ::..||.|...     ||:| .|..||.||||||||||.|||
Human   118 SQKSCQLKKSLETAGDCK-----AAEESERPKPR-----SRRK-PRVLFSQAQVFELERRFKQQR 171

  Fly   199 YLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGA------SKRVPVQVLVRE 257
            |||.|||..:|.||:||.|||||||||||||.||:  :|.::..|||      .:||.|.||||:
Human   172 YLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQ--RQDKSLELGAHAPPPPPRRVAVPVLVRD 234

  Fly   258 D-----------------GSTTYAHMAAPGAGHG 274
            .                 |::.|::.:.|..|:|
Human   235 GKPCVTPSAQAYGAPYSVGASAYSYNSFPAYGYG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 40/52 (77%)
NKX2-3NP_660328.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..153 8/31 (26%)
HOX 148..204 CDD:197696 42/56 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.